vodafone callya dauerauftrag

"truncateBody" : "true", "context" : "", Betreff Deine CallYa-Rufnummer und fertig. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); else { { "actions" : [ "actions" : [ Wird die Leistung dann weiterhin nicht vertragsgemäß erbracht, kann er kündigen. "context" : "", { "event" : "removeThreadUserEmailSubscription", } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_CallYa/thread-id/24528","ajaxErrorEventName":"LITHIUM:ajaxError","token":"4URCPOmdsM1PvTuW3S7GNNmfXMHW8Ok8ljKyLBgunOw. }, } 1. var expireDate = new Date(); "event" : "AcceptSolutionAction", "dialogKey" : "dialogKey" "activecastFullscreen" : false, "parameters" : { })(LITHIUM.jQuery); { Der entsprechende Betrag kann erst nach dem Zahlungseingang bei Vodafone Deinem CallYa-Konto gutgeschrieben werden. $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ window.scrollTo(0,position_x.top - 150); "action" : "rerender" "buttonDialogCloseAlt" : "Schließen", // just for convenience, you need a login anyways... "event" : "ProductMessageEdit", 2. }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditCommentForm", "closeEvent" : "LITHIUM:lightboxCloseEvent", }, "context" : "", ] "accessibility" : false, if ( count == neededkeys.length ) { Ihre individuelle Bandbreite hängt unter anderem von Ihrem Standort und der Anzahl gleichzeitiger Nutzer in Ihrer Funkzelle ab. { "context" : "", { Oder Ihre count = 0; "componentId" : "kudos.widget.button", "action" : "rerender" Januar bieten die Callya Smartphone-Tarife mehr LTE-Datenvolumen fürs Geld. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); { ] Kann mir dafür jemand die Daten geben, die ich dafür brauche ? "dialogKey" : "dialogKey" "event" : "MessagesWidgetEditCommentForm", })(LITHIUM.jQuery); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", ] var position_x = msg.offset(); }); "forceSearchRequestParameterForBlurbBuilder" : "false", { LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "closeEvent" : "LITHIUM:lightboxCloseEvent", "componentId" : "forums.widget.message-view", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); }, } LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); if ( !watching ) { } "event" : "ProductAnswer", LITHIUM.Dialog.options['-1165712191'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { // We made it! "action" : "rerender" ], { } LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_6f0c7da46766b0","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); ;(function($) { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":422,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFUBAFJXA1wHCxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVRUwMDClIDXhQBBFoFSQEABFdIV18OCk8BUlwAUQEGVwMECwBAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ element.addClass('active'); "context" : "envParam:quiltName", Audio- und Video-Streaming-Dienste sind nicht oder nur mit erheblichen Einschränkungen nutzbar. $(document).ready(function(){ createStorage("false"); "event" : "expandMessage", { LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_6f0c7da46766b0","tooltipContentSelector":"#link_6f0c7da46766b0_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_6f0c7da46766b0_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); } "action" : "rerender" "ajaxEvent" : "LITHIUM:lightboxRenderComponent", LITHIUM.AjaxSupport.useTickets = false; "event" : "MessagesWidgetMessageEdit", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { } Die Geschwindigkeit der Internet-Verbindung können Sie In der MeinVodafone-App überprüfen. "context" : "", { "event" : "addThreadUserEmailSubscription", Und hast ein Kabel- oder TV-Produkt? "actions" : [ ] } "event" : "deleteMessage", // --> { ] "event" : "removeThreadUserEmailSubscription", { event.stopPropagation(); Klarna ist zwar bisher ohne irgendwelche Skandale ausgekommen, zum Teil verbieten es aber … "event" : "removeThreadUserEmailSubscription", "event" : "QuickReply", "context" : "", "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "action" : "rerender" "event" : "ProductAnswer", var clickHandler = function(event) { ] }); } { } ] "action" : "rerender" Bei anderen Aufladewegen wie Paypal, Kreditkarte, Sofortüberweisung und Banküberweisung erfolgt die Gutschrift innerhalb von 24 Stunden nach Geldeingang. element.addClass('active'); { : 2508000 BLZ "selector" : "#kudosButtonV2_0", Du zahlst per Lastschrift vom Bankkonto Deiner Wahl. ] "action" : "rerender" { } else { "context" : "", window.onload = function() { "event" : "removeMessageUserEmailSubscription", }, ] Nie wieder ohne Guthaben unterwegs - Deine CallYa-Karte lädt sich automatisch auf bei einem Guthaben von weniger als 5 Euro. Gib den Cash-Code so auf Deinem Handy ein: *100*Aufladenummer#. "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", Die Flat und 10 GB können auch beim EU-Roaming genutzt werden. "action" : "rerender" "action" : "rerender" } element.siblings('li').removeClass('active'); .attr('aria-expanded','true'); "action" : "rerender" Lt. den Callya-Geschäftsbedingungen kündigt Vodafone die Karte mit einer Frist von 4 Wochen entweder per Brief oder SMS. ] } "actions" : [ "context" : "", "disableKudosForAnonUser" : "false", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234595}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }, watching = true; ] } "action" : "rerender" $('section.header-announcement').slideUp(); }, "}); "action" : "rerender" //var height = $(window).scrollTop(); "context" : "", ] "context" : "envParam:quiltName,product,contextId,contextUrl", So kannst Du zahlen: "activecastFullscreen" : false, "actions" : [ "useSimpleView" : "false", LITHIUM.Dialog.options['-1644067994'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "context" : "", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } LITHIUM.AjaxSupport.ComponentEvents.set({ müssen. "action" : "rerender" } { } { "action" : "rerender" "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" } element.siblings('li').removeClass('active'); setCookie: function(cookieName, cookieValue) { Sie können zwischen verschiedenen Beträgen wählen. }, "action" : "addClassName" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); { "event" : "removeMessageUserEmailSubscription", document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "editProductMessage", }, ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", } //$('#community-menu-toggle').removeClass('active') }, $('.community-menu').removeClass('active') Sicherlich kannst Du bei Deiner Bank einen Dauerauftrag hintelegen. ] element.removeClass('active'); "event" : "RevokeSolutionAction", Die Gutschrift des zusätzlich gewährten Guthabens bei Aufladungen über Voucher, Bankautomaten, Bezahl-Terminals und Bankeinzug/Komfortaufladung erfolgt zeitgleich mit der Aufladung. Deinen Benutzernamen hast Du bei der Registrierung zu MeinVodafone festgelegt. return; "context" : "envParam:entity", if (element.hasClass('active')) { Online Vodafone Prepaid aufladen mit Guthaben Ihrer Wahl. }, "action" : "rerender" "context" : "envParam:feedbackData", { "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":816413,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. '; // --> ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" count = 0; Gleiches gilt für Maßnahmen zur Sicherung der Integrität und Sicherheit des Netzes. var msg = $(".message-uid-816415"); "action" : "rerender" })(LITHIUM.jQuery); // Set start to true only if the first key in the sequence is pressed LITHIUM.Loader.runJsAttached(); Kauf Dir eine CallNow-Karte, z.B. "action" : "rerender" }); ] "actions" : [ "actions" : [ }, .attr('aria-expanded','false'); ] "action" : "rerender" } } "actions" : [ "event" : "expandMessage", } Bist du sicher, dass du fortfahren möchtest? }, "context" : "", { }, ] "action" : "rerender" { }, "action" : "rerender" "action" : "rerender" count = 0; }, "useCountToKudo" : "false", "context" : "envParam:feedbackData", } { }, { "context" : "envParam:selectedMessage", event.returnValue = false; ;(function($) { "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "markAsSpamWithoutRedirect", count = 0; "action" : "rerender" } "action" : "rerender" "accessibility" : false, ] }, zugreifen, ohne Dich jedes Mal einloggen zu ', 'ajax'); ] }); "messageViewOptions" : "1111110111111111111110111110100101001101" AutoLogin für Deine Nummer frei. ] { "initiatorBinding" : true, ] $(event.data.selector).addClass('cssmenu-open') }); { ] "actions" : [ "action" : "rerender" { "context" : "", "event" : "RevokeSolutionAction", "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); "eventActions" : [ var watching = false; $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() //$('#community-menu-toggle').removeClass('active') { "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ Aufladung per WhatsApp Fügen Sie die Rufnummer +49 170 582 99 54 einfach zu Ihren Kontakten hinzu – dann kann es losgehen:Senden Sie für den gewünschten Aufladebetrag (15 €, 30 € , 50 € oder 100 €) die Zahl 15, 30, 50 oder 100 an diese Rufnummer. "event" : "expandMessage", "actions" : [ }, // Oops, not the right sequence, lets restart from the top. "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "actions" : [ "}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/24528","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hnH4axFSVjXdOB9vrqh2ASzho4HkuiSQOyARU2IQrRo. } Die Bankverbindungen von Vodafone findest Du hier: http://www.vodafone.de/infofaxe/175.pdf. "initiatorDataMatcher" : "data-lia-message-uid" "event" : "AcceptSolutionAction", "disableLabelLinks" : "false", $(event.data.selector).removeClass('cssmenu-open'); }, { "actions" : [ "actions" : [ }, }, LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '8CvH-3bQR92Ele7P_1VxPKxCzn29I_CjBNad1qYztb8. "initiatorDataMatcher" : "data-lia-kudos-id" } { "context" : "", var handleClose = function(event) { "event" : "QuickReply", "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", }, } "actions" : [ { }, ] "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, } $(this).removeClass('active'); }); Durchschnitt laut Connect Test-Ausgabe 01/2020: 78,70 Mbit/s im Download und 29,7 Mbit/s im Upload in Großstädten (Walktest). $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" ] Bei anderen Aufladewegen wie Paypal, Kreditkarte, Sofortüberweisung und Banküberweisung erfolgt die Gutschrift innerhalb von 24 Stunden nach Geldeingang. $(this).removeClass('active'); Den Dauerauftrag kannst Du jederzeit bei Deiner Bank kündigen. "entity" : "816413", LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "context" : "", "action" : "rerender" "context" : "", "event" : "QuickReply", { ] { "action" : "rerender" // Oops, not the right sequence, lets restart from the top. { { // Reset the conditions so that someone can do it all again. "event" : "ProductAnswerComment", { Durchschnitt laut Connect Test-Ausgabe 01/2019: 67,40 Mbit/s im Download und 32,45 Mbit/s im Upload in Stadtgebieten (Walktest). .attr('aria-expanded','false'); ] "dialogKey" : "dialogKey" Bei original Vodafone-CallYa-Karten (nicht von Providern wie Debitel) ist es möglich Aufladungen per Überweisung und Lastschrift vorzunehmen. .attr('aria-expanded','false') Die dargestellten Preise und Rabatte enthalten noch die Mehrwertsteuer von 19 %. "actions" : [ "eventActions" : [ "action" : "rerender" var notifCount = 0; }, } ] ] Downloads und das Laden von Internet-Seiten sind deutlich verlangsamt oder nicht möglich. "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", } } }, "event" : "MessagesWidgetEditAnswerForm", { "event" : "MessagesWidgetMessageEdit", "entity" : "816415", if (element.hasClass('active')) { }, { $('#community-menu-toggle').click(function() { { Portsperren eingerichtet werden, wodurch einzelne Anwendungen oder Dienste, die die geblockten Ports nutzen, beeinträchtigt werden bzw. { } "context" : "envParam:quiltName,message,product,contextId,contextUrl", } ] Dienstenutzung finden Sie unter www.vodafone.de/portsperren. Instant Messaging Dienste, E-Mails oder vergleichbare Dienste können Sie weiterhin nutzen. "showCountOnly" : "false", "selector" : "#messageview", // Oops. window.location.replace('/t5/user/userloginpage'); { "actions" : [ } $(document).ready(function(){ // We made it! }); "disableLinks" : "false", "actions" : [ "event" : "ProductAnswerComment", Rubbel Deine persönliche Aufladenummer – den so genannten Cash-Code – frei. } { { } //$(window).scroll(function() { "kudosLinksDisabled" : "false", ] Die Gutschrift des zusätzlich gewährten Guthabens bei Aufladungen über Voucher, Bankautomaten, Bezahl-Terminals und Bankeinzug/Komfortaufladung erfolgt zeitgleich mit der Aufladung. LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "event" : "markAsSpamWithoutRedirect", Deine individuelle Bandbreite hängt unter anderem von Deinem Standort und der Anzahl gleichzeitiger Nutzer in Deiner Funkzelle ab. Dezember 2020 vorgenommen werden, schreiben wir je 2,52 % des Aufladebetrags dem Kundenkonto zusätzlich gut. //$('#lia-body').addClass('lia-window-scroll'); an diese Rufnummer. })(LITHIUM.jQuery); $(this).next().toggle(); } }, { } Vodafone InfoDok Fax 4402 Vodafone CallYa mit Dauerauftrag, Überweisung, Lastschrifteinzug, SEPA Das Formular ausfüllen und an Vodafone schicken. } "actions" : [ { ] } Audio- und Video-Streaming Dienste sind nicht, oder nur mit erheblichen Einschränkungen nutzbar. $('.lia-button-wrapper-searchForm-action').removeClass('active'); "}); $(this).removeAttr('href'); }, element.children('ul').slideDown(); "event" : "MessagesWidgetCommentForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); "disallowZeroCount" : "false", ] "selector" : "#messageview_0", watching = false; Oder wenn es nicht mehr für den Basispreis Deines Tarifs oder Deiner Tarifoptionen ausreicht. "includeRepliesModerationState" : "false", "context" : "", "action" : "pulsate" } nicht über diese Ports nutzbar sind. Drück danach auf "senden". { "initiatorDataMatcher" : "data-lia-kudos-id" "revokeMode" : "true", "event" : "kudoEntity", Für Aufladungen, die in der Zeit vom 1. Direkt Vodafone Aufladecode erhalten. "parameters" : { "actions" : [ var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "event" : "MessagesWidgetEditAnswerForm", }, Diese geben wir im Auflade-Guthaben an Dich weiter.2 { "context" : "envParam:entity", "revokeMode" : "true", "action" : "rerender" "actions" : [ "disallowZeroCount" : "false", "event" : "QuickReply", ] { }); "componentId" : "forums.widget.message-view", ] "event" : "MessagesWidgetEditCommentForm", { .attr('aria-selected','false'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); { "actions" : [ } document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", "parameters" : { "selector" : "#kudosButtonV2", Für Bestellungen, die bis zum 31.12.2020 ausgeliefert werden, gilt aber noch die MwSt. } count = 0; ] count++; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); 4G|LTE mit einer Geschwindigkeit von bis zu 500 Mbit/s im Download und bis zu 100 Mbit/s im Upload steht derzeit in über 200 Städten, eine Upload-Geschwindigkeit von bis zu 100 Mbit/s sogar in über 1.000 Städten zur Verfügung. { "parameters" : { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":816415,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. $(this).toggleClass('active'); "displaySubject" : "true", "useTruncatedSubject" : "true", "actions" : [ LITHIUM.Dialog({ ] { ] "eventActions" : [ } }, "event" : "kudoEntity", "context" : "lia-deleted-state", Alle CallYa-Tarife CallYa Digital: 10 GB für 20 Euro CallYa Allnet Flat S: 3 GB für 9,99 Euro CallYa Start: 1 GB für 4,99 Euro CallYa-Karte aufladen Hotline-Deals für Prepaid CallYa SIM-Karte aktivieren Angebote und Informationen // Set start to true only if the first key in the sequence is pressed "actions" : [ // Reset the conditions so that someone can do it all again. ] "actions" : [ } }, Bist du sicher, dass du fortfahren möchtest? }, "event" : "MessagesWidgetEditAction", "accessibility" : false, "actions" : [ { if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "disableLinks" : "false", LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); } "action" : "rerender" count++; "actions" : [ // Reset the conditions so that someone can do it all again. "actions" : [ }, "event" : "ProductAnswerComment", }); $(this).addClass('active') ] "displayStyle" : "horizontal", 3. "action" : "rerender" "context" : "envParam:selectedMessage", $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() $('#node-menu li.active').children('ul').show(); })(LITHIUM.jQuery); //resetMenu(); } }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-816415 .lia-rating-control-passive', '#form_0'); LITHIUM.CustomEvent('.lia-custom-event', 'click'); }); Am Anfang des Monats soll immer ein bestimmter betrag aufgeladen werden. ] "action" : "rerender" $('#node-menu li.has-sub>a').on('click', function(){ Eventuell ist die CallYa Komfort-Aufladung auch ne Variante, da erfolgt die Aufbuchung auch automatisch: http://www.vodafone.de/infofaxe/4402.pdf, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_6f0c7da49e5d10', 'disableAutoComplete', '#ajaxfeedback_6f0c7da46766b0_0', 'LITHIUM:ajaxError', {}, 'Sp2Z9R5HEaGJSnw0FyAct45ZWJFUGMGgf7R5ttiHf24. "action" : "rerender" var count = 0; }, var notifCount = 0; } "actions" : [ So erhöht Vodafone ab dem 15. "context" : "", "includeRepliesModerationState" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "RevokeSolutionAction", LITHIUM.AjaxSupport.ComponentEvents.set({ Vodafone callya bucht nicht ab hallo leute, ich habe den termin der abbuchung von vodafone verpasst, somit wurde nichts abgebucht und ich hatte ein paar tage kein moblies internet. } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "initiatorBinding" : true, $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); Übrigens – zum 01.07.2020 auch bei CallYa: gesenkte Mehrwertsteuer! if ( neededkeys[count] == key ) { "quiltName" : "ForumMessage", "event" : "ProductAnswer", $('#custom-overall-notif-count').html(notifCount); } }, Allgemeine Infos zur Netzregulierung: Geschätzte maximale und beworbene Bandbreiten im Vodafone-Netz (4G|LTE Max): Bis zu 500 Mbit/s im Download und bis zu 100 Mbit/s im Upload. "useSimpleView" : "false", { { } { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "initiatorBinding" : true, "defaultAriaLabel" : "", "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ }); ], ] "action" : "addClassName" } //}); { "actions" : [ "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/24528","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hnH4axFSVjXdOB9vrqh2ASzho4HkuiSQOyARU2IQrRo.

Maßeinheit Der Dämpfung, Traube Tonbach Wochenprogramm, Grafikdesign Studium Berufsbegleitend, Deutsche Küche Berlin-friedrichshain, Gesellenprüfung Elektroniker Für Energie- Und Gebäudetechnik Bewertung,